PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009639P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 175aa    MW: 18949.4 Da    PI: 10.1482
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009639P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP139.87.3e-4480155176
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                     +CqvegC++dl++ak y++rhkvC++hsk+p+v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  MELO3C009639P2  80 RCQVEGCRVDLTDAKAYYSRHKVCTMHSKSPKVIVAGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKP 155
                     6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-3575142IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.89E-4278160IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.52278155IPR004333Transcription factor, SBP-box
PfamPF031104.6E-3381154IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MEMDCSSLTE SGGSSNSSPP NSSAESLNGL KFGQKIYFED VGIAELPKSG GGSFSSSAVI  60
ASTPTKKPRG GVVHPAQPPR CQVEGCRVDL TDAKAYYSRH KVCTMHSKSP KVIVAGLEQR  120
FCQQCSRFHQ LPEFDQGKRS CRRRLAGHNE RRRKPPPGSL LSPRYGRFSS SIFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-33811541184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443072.11e-124PREDICTED: squamosa promoter-binding-like protein 9
SwissprotQ700W21e-49SPL9_ARATH; Squamosa promoter-binding-like protein 9
TrEMBLA0A0A0LBC11e-102A0A0A0LBC1_CUCSA; Uncharacterized protein
STRINGVIT_08s0007g06270.t014e-71(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.17e-50squamosa promoter binding protein-like 15